PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cz04g37130.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Sphaeropleales; Chromochloridaceae; Chromochloris
Family NF-YB
Protein Properties Length: 138aa    MW: 14834.7 Da    PI: 5.3236
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cz04g37130.t1genomePhytozomeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB179.14.1e-5611106196
          NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96 
                    vreqdrflPian+srimkk+lPanaki+kdaketvqecvsefisf+tseasdkcqrekrktingddllwa+ tlGf+dy+epl++yl+k+re+e++
  Cz04g37130.t1  11 VREQDRFLPIANISRIMKKALPANAKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMKTLGFDDYLEPLTLYLAKFREAEQA 106
                    69******************************************************************************************9986 PP

Sequence ? help Back to Top
Protein Sequence    Length: 138 aa     Download sequence    
MSGDGDDGGS VREQDRFLPI ANISRIMKKA LPANAKIAKD AKETVQECVS EFISFITSEA  60
SDKCQREKRK TINGDDLLWA MKTLGFDDYL EPLTLYLAKF REAEQASLQK QGGALGGNGS  120
GELKREGGPS GSLAKGY*
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38880.34e-62NF-YB family protein