PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cz02g12190.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Sphaeropleales; Chromochloridaceae; Chromochloris
Family GATA
Protein Properties Length: 384aa    MW: 40626.5 Da    PI: 8.2684
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cz02g12190.t1genomePhytozomeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA47.72.1e-155387135
           GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                   C +C+tt+ p+WR+gp g  +LCnaCG+++ ++g+
  Cz02g12190.t1 53 CDWCHTTSAPQWRKGPAGFDSLCNACGVRFSRTGT 87
                   99****************************99987 PP

Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    
MTAGAVDTLN KRSRKQTAKM LEAHTFSLSN DHKLRAPAVP STIQKDKLSN MLCDWCHTTS  60
APQWRKGPAG FDSLCNACGV RFSRTGTLDR VTKHMKGVHD RPAWKPATRG STGRPSKARA  120
ASSDSRPRIR RRTMTAGAAS SHPNNRKVDG QAACSMLGSG LCGVQQQQVP CPLLDHLADI  180
ASELSEAESF SEDARQEDHT PTVSDVQQNA TSMPASPNRR SCITARQLHC DQSLSLGLSR  240
FAQQAEAGNT GSPALQATSL GGIGMHATSD GEGDGDDVCR SPSPRTMSAA DSLRQLQTSE  300
QLSYSDEAAS YGTAAAAQAA NNQQGHPPCP PLGCFSLMQP DAMLVQYMNM PSTVMLVAPA  360
GHQCGVHTSY TLQGLVALAA SLL*
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08010.23e-09GATA family protein