PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AUR62037704-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Atripliceae; Chenopodium
Family B3
Protein Properties Length: 155aa    MW: 18531.3 Da    PI: 8.8025
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AUR62037704-RAgenomePhytozomeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B340.16.5e-133691786
                    E--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
              B3 17 vlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86
                    ++p +f+ ++     +g++ +   ++l++es r W+vk+  ++++   ++++GW+eF+  n+L   Df+vF +++
  AUR62037704-RA  3 SIPVSFL-RYleeelQGQPLK--SVVLMTESQRHWDVKI--EGGR---YFKDGWQEFCLYNQLGMDDFLVFIHQS 69
                    7999999.5558877667655..6***************..6665...79*********************9643 PP

2B355.31.2e-17771501792
                     E--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS
              B3  17 vlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefel 92 
                     +lp +f +++g + + + ++tl d +  sW+v+l+++++++++++++GW++F  an+L+ gD++ F+l + +++++
  AUR62037704-RA  77 YLPMRFSRSNGFV-NINYDMTLVDVDDMSWRVRLTFNRNRRQCYIKRGWSSFQAANNLNPGDILSFQLLR-TGKRP 150
                     69********888.5789*************************************************987.44445 PP

Sequence ? help Back to Top
Protein Sequence    Length: 155 aa     Download sequence    
MQSIPVSFLR YLEEELQGQP LKSVVLMTES QRHWDVKIEG GRYFKDGWQE FCLYNQLGMD  60
DFLVFIHQSQ LLFHVEYLPM RFSRSNGFVN INYDMTLVDV DDMSWRVRLT FNRNRRQCYI  120
KRGWSSFQAA NNLNPGDILS FQLLRTGKRP ILKCY
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31690.16e-16B3 family protein