PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AUR62031622-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Atripliceae; Chenopodium
Family B3
Protein Properties Length: 220aa    MW: 24756.1 Da    PI: 4.8371
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AUR62031622-RAgenomePhytozomeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3444.1e-141161931596
                     -EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
              B3  15 rlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                     +++lp +f ++  +k + +   ++ ++ g+sWe ++  ++ ++   + + W+ F+++n+Lk+gD++vF+l+++s++ l++kv
  AUR62031622-RA 116 QVILPIQFSQALPNK-TIP---VILTRGGKSWETTYLGENAPSYKRFDSRWRAFAEDNNLKVGDVCVFELVEQSDTLLKFKV 193
                     578888888666433.343...4566899*******9999999999************************988777666654 PP

Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    
MHEQTEGKFD VEQEIIGPSG NGIVHNTIDL HPGLFTDVSE LPVGRTRGRR RRPDLFALRW  60
GTKQVYEDTI TPLYIEESTS TDDSCQDVDI EPLSGKPYFP IVIVKSHIGL VAYKYQVILP  120
IQFSQALPNK TIPVILTRGG KSWETTYLGE NAPSYKRFDS RWRAFAEDNN LKVGDVCVFE  180
LVEQSDTLLK FKVQVLQGDF PSMLLNKEDG TINNPIVVE*
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18000.14e-08B3 family protein