PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AUR62028980-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Atripliceae; Chenopodium
Family B3
Protein Properties Length: 472aa    MW: 52877 Da    PI: 5.0388
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AUR62028980-RAgenomePhytozomeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B349.29.3e-162022721588
                     -EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
              B3  15 rlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                      l++pk+ ++   ++++    +tl++++g sW v+l++r   gr+ l+kGW+eFv +n+L +gD+++F++++++
  AUR62028980-RA 202 SLTIPKPVLNGKALSNK--EAVTLQNQEGSSWPVELRFRAD-GRVDLAKGWREFVIDNELIAGDTLTFEFVSNN 272
                     58999999977766643..47***************86655.689************************88754 PP

2B343.65.2e-143484291196
                     HHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
              B3  11 lksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                     ++++ l +pk  a++ ++++  +  l+l d++gr+W ++++ r+++gr+ l++GW +F k  g  +gD+++F+++   ++ ++v +
  AUR62028980-RA 348 TRNSYLHIPKAIASRQKLEN--KDILVLCDPEGRKWLMEVRTRQSDGRVGLGRGWIDFTKTYGFGAGDTLIFEFVT--DRMMNVNI 429
                     567789*******9997773..348999*********************************************764..44445555 PP

Sequence ? help Back to Top
Protein Sequence    Length: 472 aa     Download sequence    
MDNKRKLSFK KASFIKVLED EFTKKLPLPP AFTKIFEDYI PLWLILEISG TRKCWRVDIE  60
KDENGSLCLS CGFNCFVKAH SVEVGNFLLF ELEEPSILQV KIYEKDGSEK TVGTTLESGY  120
EVGAFESPRK TPSTHREGEA SPWPTTPLGT NFESGYEVGA FESPTETPLI HKEGEASPWS  180
KTPIKKKGVK PEVFGSYIAY WSLTIPKPVL NGKALSNKEA VTLQNQEGSS WPVELRFRAD  240
GRVDLAKGWR EFVIDNELIA GDTLTFEFVS NNVIQVNVDR ASQVDNPSQR EQECKIEPME  300
LIDMTCENEE LAANCIINTN TPVTMDKFER VSLESKSPSF SLTWTEKTRN SYLHIPKAIA  360
SRQKLENKDI LVLCDPEGRK WLMEVRTRQS DGRVGLGRGW IDFTKTYGFG AGDTLIFEFV  420
TDRMMNVNII KVGGLNHAVT GDIDNATSVE ASLIAQKSQN SPWGSNVQSL F*
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24700.13e-16B3 family protein