PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AUR62028979-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Atripliceae; Chenopodium
Family B3
Protein Properties Length: 443aa    MW: 50347.2 Da    PI: 7.0319
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AUR62028979-RAgenomePhytozomeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B334.92.8e-1117674396
                    S-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
              B3 43 grsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96
                     + W+v++  + ++gr+++++GW +Fv+a+ L +g f++F+++++s f  + ++
  AUR62028979-RA 17 RNCWRVEVE-KDGDGRMYFRDGWADFVEAHSLGVGNFLLFEYEEQSIF--KARI 67
                    477*****4.34444589************************987877..5454 PP

2B338.12.7e-121482221695
                     EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3  16 lvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                      ++pk    +++++  ++ +l+++d +g+ W+v+l + +++gr +l  GW+eF ++n+++ gD + F++++++    +v+
  AUR62028979-RA 148 STIPKAISLKMKLP--SKDDLKFQDVQGKCWTVTLGH-RRDGRAILCHGWREFMNENKIEHGDKLKFEFMSDELV--KVH 222
                     47888888788777..4458***************55.5555677888********************9876555..333 PP

3B340.74.3e-132903581586
                     -EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
              B3  15 rlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                      l++pk  a+  ++ k+e   ++l+d++g+ W +++  + ++gr+vl+kGW eF k  g+++gD++ Fk+++
  AUR62028979-RA 290 YLYMPKAIARVQKLMKKE--SIVLRDPEGKCWPLQI-KNLSGGRVVLAKGWAEFYKGYGIRTGDMLEFKFVS 358
                     489999999888777666..5***************.3555666*************************765 PP

Sequence ? help Back to Top
Protein Sequence    Length: 443 aa     Download sequence    
MNGYIPHRFI IESGSTRNCW RVEVEKDGDG RMYFRDGWAD FVEAHSLGVG NFLLFEYEEQ  60
SIFKARIYDR NGCERSVLVD SKGGGGQQQP QKTIDVEGEE SEALEYEPVL VKCHRKKPTR  120
LAPRKYGRGI YKKNRAVPRA YRRTAKLSTI PKAISLKMKL PSKDDLKFQD VQGKCWTVTL  180
GHRRDGRAIL CHGWREFMNE NKIEHGDKLK FEFMSDELVK VHVTKASEVD EHQSDEVTGS  240
LDVDCKHDNK PSTQTPNDKE IETRMTTKKN ICESGSSFSI TWKESGVRTY LYMPKAIARV  300
QKLMKKESIV LRDPEGKCWP LQIKNLSGGR VVLAKGWAEF YKGYGIRTGD MLEFKFVSEY  360
LIHLSINRTY RSPTPIEPDD KDVVICLETL DNEEALAIEP GAVITQGEFD AATEPEAIIT  420
KDEFVAEFDA ATTRPEVNGV IN*
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24700.12e-19B3 family protein