PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AUR62026866-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Atripliceae; Chenopodium
Family B3
Protein Properties Length: 436aa    MW: 48984.2 Da    PI: 9.897
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AUR62026866-RAgenomePhytozomeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B344.72.3e-14368434572
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHH CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkan 72 
                     +++s++ k+g ++lpk+f+  +g+   +    ++ d +g+sW+vkl+y+++sg+ +++kGWk+F  an
  AUR62026866-RA 368 TLTSYSIKKGVVYLPKSFVVLNGLRRMCC-NARVIDGKGKSWQVKLNYWNSSGQAYISKGWKQFQAAN 434
                     579*******************9998775.9*********************************9998 PP

Sequence ? help Back to Top
Protein Sequence    Length: 436 aa     Download sequence    
MGSITLFELR LFHSIDRVLF SKLVTALKIQ ASQALLIMAL LFWLEDANHC KIISKLADLS  60
DNLLDAVINE VVLCINCLKT KTPTTHGGSL HLLSRMMDKE ISLKIICDMK YTAISCVKDY  120
LNDVCAWIFT DILMQVLQKS SNLTLNRPFF VPGFPHPTFG PLEISIVPLN AIVPSKGIWG  180
WKLEFEAPIE DRTLFLTFSR GFPVSQEEVM QFFTQMCGNC IENFQMEVVN NHSSKVQSLY  240
ARMGLRSVAY VDQIMRGKHL AMFRSKVISI VILKQPKDGV AGLSVFDGGA DDKGSASPSL  300
DCRNRRRSPL VRCLFTIDTI GSRKDTSKMN FRSTTLSTRK RKRQDSETEN ATSPVLNRQC  360
QSPSCRITLT SYSIKKGVVY LPKSFVVLNG LRRMCCNARV IDGKGKSWQV KLNYWNSSGQ  420
AYISKGWKQF QAANS*
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00260.19e-11B3 family protein