PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AUR62026865-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Atripliceae; Chenopodium
Family B3
Protein Properties Length: 216aa    MW: 24087.5 Da    PI: 7.5779
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AUR62026865-RAgenomePhytozomeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B352.87.2e-17120208696
                     ..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
              B3   6 tpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                     +++ v ++g+ +lpk f+++ g+ +++   ++l d +g+ W+v l+y+k+ g+ ++++GWk+F  angLk g  +vF++ + +++ +v+k 
  AUR62026865-RA 120 LSPTVINKGQAYLPKGFVKSSGLLNRQ-CYMKLIDGKGKAWTVMLKYKKSNGQSYIGQGWKDFQIANGLKLGHNIVFQFLQ-DGEMPVLKC 208
                     57889999**********999877655.59************************************************887.444466655 PP

Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    
MHTTKISEEP NSNNGAKFMQ PLIPGFLNTF SIPVSYMECV EMELHGHQPE GVALVTDDNH  60
HWAVKLEGGR RFGDGWKEFC EHNELSVGIE KRGNPMEEDD AATAQVPSAE SKYPTYNVTL  120
SPTVINKGQA YLPKGFVKSS GLLNRQCYMK LIDGKGKAWT VMLKYKKSNG QSYIGQGWKD  180
FQIANGLKLG HNIVFQFLQD GEMPVLKCFQ FPKSP*
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31615.11e-21B3 family protein