PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AUR62025735-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Atripliceae; Chenopodium
Family B3
Protein Properties Length: 1158aa    MW: 129935 Da    PI: 5.3304
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AUR62025735-RAgenomePhytozomeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B348.91.2e-1561151199
                     EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                     ffkv+    +l s  l +p +fa+++ +   e+k   led++g++W+v+l  ++  g+  ++kGW +F  ++g++ gD vvF++ + s f   v+
  AUR62025735-RA  61 FFKVM--FGNLFSEVLFVPPRFAKTIIHL--EGKNTYLEDPTGQKWKVNL--SNVNGSLAFEKGWHDFSVDHGIELGDLVVFHYFKGSHF--IVQ 147
                     55666..4556667799******999433..46689**************..999999*************************9987888..999 PP

                     EE-S CS
              B3  96 vfrk 99 
                     +f +
  AUR62025735-RA 148 IFGR 151
                     9987 PP

2B333.67.1e-114635451496
                     T-EE--HHH.HTT..---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
              B3  14 grlvlpkkfaeeh..ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                     + l lpk+   ++  +g++ e+  + l+d+  r W v +   +++g+ vl++GWkeF kan +  gD ++F +++ +e+   v++
  AUR62025735-RA 463 SYLALPKPLPIKIrrQGDSLEQNLVLLRDPLQRLWPVIY--HQRKGSEVLANGWKEFRKANCIHPGDECTFVVENIDEGIIQVQI 545
                     448899999888888777778889***************..77778889**********************96544777666665 PP

3B350.83e-16586676199
                     EEEE-..-HHHHTT-EE--HHH.HTT..---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh..ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93 
                     ffkv+       s +l +p kf  ++  +     +k+  led++g++Wev l  +  +g++ +++GW++F  ++gL++gDfvvF+++  s+f   
  AUR62025735-RA 586 FFKVM--YGKKFSEQLFVPPKFS-RIlvS---SVGKKACLEDLTGQKWEVVL--SDVQGSVAFQEGWRKFSLDHGLDQGDFVVFRYVTGSRF--I 670
                     56666..33334567999****8.55332...34679***************..999999**************************977888..8 PP

                     EEEE-S CS
              B3  94 vkvfrk 99 
                     v ++ k
  AUR62025735-RA 671 VEIYGK 676
                     887765 PP

4B340.26.1e-13109011512993
                      -..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
              B3   29 kkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93  
                      + +++k ++l+d+ gr W v +   k+ + +vl++GWkeF kan++++gD + F  +++ ++ + 
  AUR62025735-RA 1090 D-KKHKLISLKDPAGRDWPVLY--HKRNNLFVLASGWKEFRKANKICSGDECAFVAENTVKGAFQ 1151
                      3.35679***************..999999************************97766555455 PP

Sequence ? help Back to Top
Protein Sequence    Length: 1158 aa     Download sequence    
MSSAVLANRL QTSLMMADYV SPAVYNHVVM GDKGEACAEC SRSCSSFHRT MHDPYPIVSS  60
FFKVMFGNLF SEVLFVPPRF AKTIIHLEGK NTYLEDPTGQ KWKVNLSNVN GSLAFEKGWH  120
DFSVDHGIEL GDLVVFHYFK GSHFIVQIFG RSGCEKPMIY NGMDYQNKRA RLTRTDPCDS  180
PHNKEPTPEK ECLDSCMETE PNVDVHNVEK SPEIGVNVSR EGNINKQPEE VPTADPLVES  240
FFMGDRNTSY TSEDQRVDLY DLSIFEMPGH KADADKISML MEYTCSEVPS ALQQNQSEEV  300
SPDVVNFQMA ETINETSNEE DASRKECLPV LNNTVSGAEV PLDICMPLKS VTLPHAPEFS  360
PPAAPVERVE PPCKDLMIYK PEPKSDKIIC GLEAKIVSRD SEISFTIKGR RIKKEDISSL  420
STSMDKNKGH IDMIVKLEEP EFCDSPSARD IKITCLVQQD NESYLALPKP LPIKIRRQGD  480
SLEQNLVLLR DPLQRLWPVI YHQRKGSEVL ANGWKEFRKA NCIHPGDECT FVVENIDEGI  540
IQVQIVSQCL QMCQMPREVE SCEECFMNCL LKHQGQNDHS PKIPPFFKVM YGKKFSEQLF  600
VPPKFSRILV SSVGKKACLE DLTGQKWEVV LSDVQGSVAF QEGWRKFSLD HGLDQGDFVV  660
FRYVTGSRFI VEIYGKSGYE KSFPSVKSYQ NKRPKTSSNS PSDPLYKERE PSQRNNCFNA  720
YTVPRSNTDM DDIIWSQDDV NNLNDSPVME ENVQRQVNVI EKPQLVPDVD LLVEPCFLND  780
RETNSAKEAN RVHLLDLSAF ESPNMNPSSS RKGDADNRFD LSISNMTSEK LDAREDLVEH  840
LSDQPPFQSF NLKPSFSMNG DRDDISNQST SKMIDKKVDN HKGNLQGNTC SLVSGAFDEA  900
QTRSTSIDTK KFLLTKGKTA VPSKNYEANL SSFKHGPVPS VSPNLPSNLM PPPNIFGITH  960
TCEPSATSGS SQPPNSNSVC GREGGTVRVV KQEPRELKQD LSDNLLAGPL FGASLSFDRE  1020
AKNNFSGLGV NIKPMEDDVE VCKEVKAEPV DFCDSPLVPA SRIICLVPSD NESFLELPEA  1080
LPIKWRQKLD KKHKLISLKD PAGRDWPVLY HKRNNLFVLA SGWKEFRKAN KICSGDECAF  1140
VAENTVKGAF QFQFLNR*
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66980.13e-13B3 family protein