PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AUR62025199-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Atripliceae; Chenopodium
Family B3
Protein Properties Length: 467aa    MW: 53169.5 Da    PI: 7.8206
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AUR62025199-RAgenomePhytozomeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B331.43.3e-1016664295
                    TS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3 42 sgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95
                    + + W+v +  + ++gr+++++GW +Fv+ + L +g f++F+++++s f    +
  AUR62025199-RA 16 TRKCWRVGVE-KDGDGRMYFRDGWADFVEVHSLGVGNFLLFEYEEQSIF--QAR 66
                    4588*****4.34444589***********************9987777..444 PP

2B342.11.6e-131692451495
                     T-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3  14 grlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                     ++l++pk    ++++++  + +l+++d +g+ W+v+l + +++gr +l  GWkeF k+n+++ gD + F++++++    +v+
  AUR62025199-RA 169 HQLTIPKAISLKMKLPS--KDDLKFQDVQGKCWTVTLGH-RRDGRAILCHGWKEFMKENKIEHGDKLKFEFMSDELV--RVH 245
                     78999999998888884..458***************55.5555677888********************9876544..343 PP

3B339.41.1e-123133811586
                     -EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
              B3  15 rlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                      l++pk  a+  ++ k+    ++l+d++g+ W +++  + ++gr+vl+kGW eF k  g+++gD++ Fk+++
  AUR62025199-RA 313 YLYMPKAIARVQKLMKKD--SIVLRDPEGKCWPLQI-KNLSGGRVVLAKGWAEFYKGYGIRTGDMLEFKFVS 381
                     489999999888777655..5***************.3555666*************************765 PP

Sequence ? help Back to Top
Protein Sequence    Length: 467 aa     Download sequence    
MNGYIPHRFI IESGSTRKCW RVGVEKDGDG RMYFRDGWAD FVEVHSLGVG NFLLFEYEEQ  60
SIFQARIYDR NGCERSILVD SKGGGGQQQP KKTIDDEGEE SEALEYEPVL VKSNRKKPTR  120
LAPRKYGRGI YKRNRAVPRA YTRTAKLSVS ENHLCFSIII HFSKKHQFHQ LTIPKAISLK  180
MKLPSKDDLK FQDVQGKCWT VTLGHRRDGR AILCHGWKEF MKENKIEHGD KLKFEFMSDE  240
LVRVHVTKAS VVDEHQSDEA TGSLDMDCKH DNKPSTQTPN DKEIETRMTT KKHIYESGSS  300
FSITWKESGV RTYLYMPKAI ARVQKLMKKD SIVLRDPEGK CWPLQIKNLS GGRVVLAKGW  360
AEFYKGYGIR TGDMLEFKFV SEYLIHLSIN RTYRSPTAIE PDEDAVICLE TSDNEEALAI  420
KPAGAVITQE EFDADIEPKA IITQDEFVAE FDAATPRPGE VNGVIN*
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24700.11e-16B3 family protein