PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AUR62025197-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Atripliceae; Chenopodium
Family B3
Protein Properties Length: 271aa    MW: 30193.2 Da    PI: 5.459
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AUR62025197-RAgenomePhytozomeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B347.53.1e-154721889
                    --HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
              B3 18 lpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89
                    +pk  ++   ++  ++ t+tl++++g sW v+l+  + +gr+ l+kGW+eFv +n+L +gD++ F++++++ 
  AUR62025197-RA  4 IPKAMLNGKPLS--NKDTVTLQNQEGSSWPVELR-IRADGRVDLAKGWREFVVDNELVTGDTLKFEFVSNNV 72
                    677776444333..4569***************6.5556789************************887544 PP

2B345.11.8e-141462201187
                     HHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
              B3  11 lksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                     ++++ l +pk  a + ++++  +  ++l d++g++W ++++ r+++gr+ l++GW +F k+ g  +gD++vF+++ +
  AUR62025197-RA 146 TRNSYLHIPKAIAIRQKLEN--KDIVVLCDPEGKKWLMEVRTRQSDGRVGLGRGWIDFTKSYGFGVGDTLVFEFVTN 220
                     5677899*****98887763..3479999********************************************8754 PP

Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    
MQTIPKAMLN GKPLSNKDTV TLQNQEGSSW PVELRIRADG RVDLAKGWRE FVVDNELVTG  60
DTLKFEFVSN NVIQVNVGRA SQVDNPSQRE QECKIEPMEL INMTCENEEL AANCIINNAP  120
GTMDKYERVS LESKSPSFSL TWTEKTRNSY LHIPKAIAIR QKLENKDIVV LCDPEGKKWL  180
MEVRTRQSDG RVGLGRGWID FTKSYGFGVG DTLVFEFVTN HMMNVNIVKA GGLNHAVTGD  240
IDKATSVETS LIAQTSQNSP WDPINAKSLF *
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24700.13e-15B3 family protein