PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AUR62022423-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Atripliceae; Chenopodium
Family B3
Protein Properties Length: 230aa    MW: 25685.2 Da    PI: 9.4938
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AUR62022423-RAgenomePhytozomeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B348.41.7e-15134220498
                     E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
              B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                      ++ps+v+   +l lp +f++++  + +++ ++tl de+++++ v +  rk++    l++GWk+F+++++L +gD v+F+++++s    +v ++r
  AUR62022423-RA 134 PMLPSHVTGGFWLGLPTDFCRRNL-P-TNDGMVTLVDEENEEYPVVYLARKRG----LSGGWKGFAESHELVDGDAVIFQVISSSVL--KVYIIR 220
                     6899****************9994.3.34459***************555555....9**********************8875555..888877 PP

Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    
MGIGKTSYEE RRQKRVEENK KRLEDLNLIH LSQALKTLSP KSSPMKKVGK PRIFDKQTVE  60
VRRSARVASN PAPVYAEISL PRFSSPRKSY GVVKARDFTN RVIASDDVRE YAIEEAEKLN  120
AKLEEEGFPT LVRPMLPSHV TGGFWLGLPT DFCRRNLPTN DGMVTLVDEE NEEYPVVYLA  180
RKRGLSGGWK GFAESHELVD GDAVIFQVIS SSVLKVYIIR GSGQDSGTD*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11150RRQKRVEENKKRLEDLNLIHLSQALKTLSPKSSPMKKVGK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42700.16e-63B3 family protein