PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AUR62021553-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Atripliceae; Chenopodium
Family B3
Protein Properties Length: 389aa    MW: 44937.6 Da    PI: 8.2581
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AUR62021553-RAgenomePhytozomeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B347.92.4e-15691461798
                     E--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
              B3  17 vlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                      +p+kf+ e+ ++k  +   tl  +s ++W+++l+ ++   +  +++GW++Fv++ng++e D++vF+++++s+f   v+vf+
  AUR62021553-RA  69 KIPRKFM-ECFKVKLLP-WCTLIGPSKNKWKIRLSSTGDETSLKFSDGWEQFVSDNGVEEADSLVFRFVKDSSF--EVTVFD 146
                     79*****.675666665.889*************99999999***************************99999..777776 PP

2B352.87.3e-17269356187
                     EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE...EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliy.rkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                     f+ +++p +v +  +l++pk+ a++h++k++ +++l +  +   sW+v +++ +++s ++ l++ W  Fv +n+L+e D++vF+l+++
  AUR62021553-RA 269 FQITMLPTHVYRGFNLTIPKNWAKKHMIKEPHEVELHVPGSIKGSWRVGCRWtKGGSIQCQLRSKWPLFVLENNLEEHDTCVFELIQK 356
                     788999*********************9999999999999999********96666667*************************9985 PP

Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    
MEKKCEGCKI AENYKYWFEF PAVKHQFFKV MLGDFKHQLV GKDVLKATVL KLLISAYLIE  60
FFGELFLQKI PRKFMECFKV KLLPWCTLIG PSKNKWKIRL SSTGDETSLK FSDGWEQFVS  120
DNGVEEADSL VFRFVKDSSF EVTVFDMSGC EREGCHFSIN SNSSSRRTSC RSTLHISHGS  180
VAKEEVEICD SSSEDCSLWD EGEEETKDVS HVMEEEREGS SSEGKLPQSQ KYFISNRRDL  240
KPGEKKRASK MAECYRRSMK DNKRVFPVFQ ITMLPTHVYR GFNLTIPKNW AKKHMIKEPH  300
EVELHVPGSI KGSWRVGCRW TKGGSIQCQL RSKWPLFVLE NNLEEHDTCV FELIQKGKLD  360
NVRTPIFNVH IFRTFDHIVP LTVSTHMV*
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G33280.11e-20B3 family protein