PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AUR62020516-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Atripliceae; Chenopodium
Family B3
Protein Properties Length: 92aa    MW: 10481.3 Da    PI: 9.7493
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AUR62020516-RAgenomePhytozomeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B335.91.4e-1131803787
                    EEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
              B3 37 tledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87
                    ++ ++  +sW++++i++   ++  l k Wk+F+ +n+Lk+gD+++F+l+++
  AUR62020516-RA 31 VILTRGTESWTMNYIVNDIVNK-RLDKRWKQFAVDNKLKVGDVCTFELMSK 80
                    44567789******88444333.49**********************9864 PP

Sequence ? help Back to Top
Protein Sequence    Length: 92 aa     Download sequence    
MSILLRRMFL LYQLTIPAEG VRLLPNIEAP VILTRGTESW TMNYIVNDIV NKRLDKRWKQ  60
FAVDNKLKVG DVCTFELMSK VPEVEGSSPS R*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15259KRLDKRWK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18000.13e-07B3 family protein