PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AUR62017524-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Atripliceae; Chenopodium
Family B3
Protein Properties Length: 469aa    MW: 54292.4 Da    PI: 6.9084
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AUR62017524-RAgenomePhytozomeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B342.98.8e-1419991699
                    EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
              B3 16 lvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99
                      +p k+++++ +++  +  +tl+  +g+ W+v+l   k +g+++l+kGW+ Fvk   Lk g f++F++d+  + e++v++f++
  AUR62017524-RA 19 QKIPEKYVKTYYEEQLANDYVTLRVNDGKIWRVEL--FKEGGKVWLSKGWECFVKKYSLKYGYFLLFRFDD-IKYEYHVTIFDT 99
                    469********444455668***************..9999***************************876.88889****997 PP

2B344.33.1e-14180269799
                     .-HHHHTT-EE--HHH.HTT---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
              B3   7 psdvlksgrlvlpkkfaeehggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                     +  ++ks +l++p  f++++g++   s ++ l+   s + W+v++  +k    + l+kGW++Fv+  +L+ g  +vF+ldg  + +++v +++k
  AUR62017524-RA 180 KLVTSKSPILRIPVVFVKKYGEQ--LSDDVYLNVpNSEKPWKVEM--KKENTDMSLGKGWQDFVEFYNLEYGHLLVFRLDGGLQSHFYVVILDK 269
                     555678889***********966..8889****94555*******..88888899*************************98666678888887 PP

3B348.41.7e-15372467198
                     EEEE-..-HHHHTT-EE--.HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS.SEE.. CS
              B3   1 ffkvltpsdvlksgrlvlp.kkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr.sefel 92 
                     f++++ ps+v ++  l++p +++a+++  ++  +s +++l+ ++g+   v + y +k+ + +l+ GWk+Fv +n+Lk+gD ++F+l++r  +f +
  AUR62017524-RA 372 FKSIMCPSHVRNKYTLSVPfNSHASTYfPSD--KSEKIILKGPTGKNHAVGY-YLGKKHAQLLS-GWKHFVWDNHLKVGDACMFELVSRkPNF-Y 461
                     788999*******999999445576666444..6679***************.66666666666.**********************995555.8 PP

                     EEEEE- CS
              B3  93 vvkvfr 98 
                     +v+++r
  AUR62017524-RA 462 KVSIHR 467
                     888876 PP

Sequence ? help Back to Top
Protein Sequence    Length: 469 aa     Download sequence    
MINYLITDIF LATSFYGKQK IPEKYVKTYY EEQLANDYVT LRVNDGKIWR VELFKEGGKV  60
WLSKGWECFV KKYSLKYGYF LLFRFDDIKY EYHVTIFDTT CFEIEYDQEF DNHTKGQQLI  120
KISSQKEGVD QDDNNDHGVI STDAKGVVDF DENKSIIESL EAFKSENPHF KVVMEYQKMK  180
LVTSKSPILR IPVVFVKKYG EQLSDDVYLN VPNSEKPWKV EMKKENTDMS LGKGWQDFVE  240
FYNLEYGHLL VFRLDGGLQS HFYVVILDKS GTEIDYPVRN SHVSKRSADS RELKNGVRED  300
HSHHTEEADD VSLETFDESS PKLNTIDSVI NLDTSDSDDV EGVSFNSKGN DEMRKKNLKK  360
KLDGLKSQYP HFKSIMCPSH VRNKYTLSVP FNSHASTYFP SDKSEKIILK GPTGKNHAVG  420
YYLGKKHAQL LSGWKHFVWD NHLKVGDACM FELVSRKPNF YKVSIHRG*
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.12e-13B3 family protein