PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AUR62006874-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Atripliceae; Chenopodium
Family B3
Protein Properties Length: 295aa    MW: 33413.8 Da    PI: 9.62
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AUR62006874-RAgenomePhytozomeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3491.1e-155653293
                    --SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
              B3 32 esktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93
                     +++++l+++ g +Wev+l +r   ++ ++++GWkeF+ka++ ke+D ++Fk++++s+f+ +
  AUR62006874-RA  5 LPQMVVLKSPGGSTWEVQL-VRDDNNTLFFKDGWKEFAKAHNFKENDLLMFKYTRDSCFKVW 65
                    5779***************.56666679***************************9***554 PP

2B338.71.8e-12182270192
                     EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefel 92 
                     f+ vl+  +v++  rl +p +  +++   k+++++l+    +g++W v+++ + + g+ v+ +GW+ F+ +n L+e D+++Fkl++++++  
  AUR62006874-RA 182 FIVVLKDCNVSQYYRLGVPAPWSRSYLTRKHQDMELR---ANGKKWIVRFNAEPRYGGGVFISGWSTFAVDNLLQESDVCLFKLVSQKDEPV 270
                     566777778888999***********76666765555...69********8877777777778********************998665543 PP

Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    
MWNELPQMVV LKSPGGSTWE VQLVRDDNNT LFFKDGWKEF AKAHNFKEND LLMFKYTRDS  60
CFKVWMLSGR NLCEIAGSYF VKKSALGKND AGENSKLKRK NTAEGSAKAT GNKDNSELED  120
LDTERASRRK NRRNSTGCGL RNSGAEEKNR STDDTLDRVP PSEADKERAL QMANRDLTVK  180
SFIVVLKDCN VSQYYRLGVP APWSRSYLTR KHQDMELRAN GKKWIVRFNA EPRYGGGVFI  240
SGWSTFAVDN LLQESDVCLF KLVSQKDEPV IFDVSIYRAV PEAAHLPSHK TPKV*
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G33280.13e-40B3 family protein