PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AUR62002339-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Atripliceae; Chenopodium
Family B3
Protein Properties Length: 141aa    MW: 16323 Da    PI: 10.4517
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AUR62002339-RAgenomePhytozomeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B330.56.2e-108533075
                    ..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT-- CS
              B3 30 keesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLk 75
                    k+ +k  +l+d++grsW+vkl  + ++ r  +++GW++F+k+ +L+
  AUR62002339-RA  8 KNDEKNAKLRDKKGRSWDVKLVTSSGDIRPHFKDGWEKFCKECDLQ 53
                    3456689**************7777777799**********99886 PP

2B3543.1e-17551311896
                     --HHH.HTT---..--SEEEEEETTS-EEEEEE...EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
              B3  18 lpkkfaeehggkkeesktltledesgrsWevkliy.rkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                     lp++fae++g++k+   ++ l de+g  W++ l++ rk+ g+ +++  Wk F kangL++gD v+F+l++ s++++v+k+
  AUR62002339-RA  55 LPREFAEKNGLSKRW-CEMELIDEKGHPWKMLLRHyRKGNGSPYIG-SWKAFRKANGLNTGDAVIFQLIH-SGERPVIKF 131
                     8********999865.59***************8757777778888.9*********************9.777788876 PP

Sequence ? help Back to Top
Protein Sequence    Length: 141 aa     Download sequence    
MGGKKLGKND EKNAKLRDKK GRSWDVKLVT SSGDIRPHFK DGWEKFCKEC DLQPLPREFA  60
EKNGLSKRWC EMELIDEKGH PWKMLLRHYR KGNGSPYIGS WKAFRKANGL NTGDAVIFQL  120
IHSGERPVIK FYIIFFIRII *
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31630.19e-14B3 family protein