PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AUR62002338-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Atripliceae; Chenopodium
Family B3
Protein Properties Length: 221aa    MW: 26116.7 Da    PI: 8.0545
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AUR62002338-RAgenomePhytozomeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B339.21.2e-1210534287
                    TS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
              B3 42 sgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87
                    s++ W vk+  + ++++  +++GW+ F+k++gL+egDf+vF+++++
  AUR62002338-RA 10 SNNYWFVKV--CYYDEKLHFKDGWETFCKDHGLEEGDFLVFQHHRN 53
                    6688*****..88888899***********************7664 PP

2B362.19.3e-20129217393
                     EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
              B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93 
                      ++++s+ l+ g + lp++fa+e+++++++  +++l+de+g++W+v l+  +k++  +++  W++F +++gLk+gD vvF+l++ s+++++
  AUR62002338-RA 129 ETFVKSYCLTWGGMPLPNEFARENDLVNKSCDEMVLKDEEGKEWTVSLRSYRKGRVAYIG-KWRNFHNEHGLKTGDPVVFELIE-SGETPK 217
                     678999******************99999999****************776666666666.7********************98.444444 PP

Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    
MLRNQRVKSS NNYWFVKVCY YDEKLHFKDG WETFCKDHGL EEGDFLVFQH HRNLIFDVFV  60
FDPTCCERPF PADFHQPSTN KVKSSSLNNL KIKDLFKNEK VEGLKLNKND KVYSTSKATF  120
KPREFPYCET FVKSYCLTWG GMPLPNEFAR ENDLVNKSCD EMVLKDEEGK EWTVSLRSYR  180
KGRVAYIGKW RNFHNEHGLK TGDPVVFELI ESGETPKMNF Y
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31680.12e-23B3 family protein