PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AUR62002336-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Atripliceae; Chenopodium
Family B3
Protein Properties Length: 351aa    MW: 40051.9 Da    PI: 6.6032
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AUR62002336-RAgenomePhytozomeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B337.63.9e-123503786
                    EEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
              B3 37 tledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86
                     l+d+s + W+vk+   +++  + +++GW+ F+k+++L+ gD +vF+++g
  AUR62002336-RA  3 LLRDKSKKIWDVKIELINNK--VQFKDGWEIFCKDHDLQIGDLLVFMHQG 50
                    589***********666665..669**********************876 PP

2B341.91.7e-131422111586
                     -EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
              B3  15 rlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                      l++pk+     g++  e+k+  l+d+s + W+vk+  + +++++ +++GW  F+++++L+ gDf+ +k++g
  AUR62002336-RA 142 ALSIPKPINIGVGSEIGENKMALLRDKSKKIWDVKI--ELSKNKVQFKDGWDIFCEDHDLQIGDFLELKYQG 211
                     58999999877788888999****************..77777788***********************976 PP

3B335.71.5e-11261345797
                     .-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
              B3   7 psdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                      +++ ks++l +p +fa+++g++k++    ++ de+gr+W + + y+k++ +y+     ++   an+ k gDfv+++l++ s++e+v+k++
  AUR62002336-RA 261 MNHSYKSAQLFIPLDFARKIGLDKRQ---YVVIDEKGRKWVLPFEYTKGKHAYIG--KLRGLYIANDFKIGDFVILELIQ-SGKEPVIKFH 345
                     356778889**************877...899*********99988888877764..5*********************9.8888999875 PP

Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    
MALLRDKSKK IWDVKIELIN NKVQFKDGWE IFCKDHDLQI GDLLVFMHQG YWVFDVFVFD  60
STACEREFAT IDDESNQSNY VIVQALSSCG VKNNSGATLN EAKDVAHEGL SRENNNDVLE  120
QTNMGSRPST FVLQNCSYES VALSIPKPIN IGVGSEIGEN KMALLRDKSK KIWDVKIELS  180
KNKVQFKDGW DIFCEDHDLQ IGDFLELKYQ GYLVFDVSVI VDPTAHVDEG LSNRTENKKI  240
QEQKTIGFKP TGHPYCTLVL MNHSYKSAQL FIPLDFARKI GLDKRQYVVI DEKGRKWVLP  300
FEYTKGKHAY IGKLRGLYIA NDFKIGDFVI LELIQSGKEP VIKFHNLLRL *
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00260.19e-23B3 family protein