PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AUR62001271-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Atripliceae; Chenopodium
Family B3
Protein Properties Length: 998aa    MW: 111182 Da    PI: 5.1446
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AUR62001271-RAgenomePhytozomeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B347.72.8e-1561151199
                     EEEE-..-HHHHTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                     ffkv+    +l s +l +p +fa++       e+k   led++g++W+v+l  ++  g+  ++kGW +F  ++g++ gD vvF++ + s+f   v
  AUR62001271-RA  61 FFKVM--FGNLFSEILFVPPRFAKTViA---LEGKYTYLEDPTGQKWKVNL--SNVNGSLAFEKGWHDFSVDHGIELGDLVVFHYFKGSNF--IV 146
                     56666..556777889*******98853...245689**************..999999*************************9987888..99 PP

                     EEE-S CS
              B3  95 kvfrk 99 
                     ++f +
  AUR62001271-RA 147 QIFGR 151
                     99987 PP

2B333.57.5e-114315111897
                     --HHH.HTT..---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS.SEE..EEEEE CS
              B3  18 lpkkfaeeh..ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr.sefelvvkvf 97 
                     lpk+   ++  +g++ e+  + l+d+  r W v +   +++g+ vl++GWkeF kan +  gD ++F +++  ++ ++ v ++
  AUR62001271-RA 431 LPKPLPLKIcrQGDSLEQNLVLLRDPLQRLWPVIY--HQRKGSEVLANGWKEFRKANCIHPGDECTFVVENIdEGSHFIVEIY 511
                     55555445555455566779***************..77778889**********************9775546666666665 PP

3B3407e-139289873293
                     --SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
              B3  32 esktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93 
                     ++k ++l+d+ gr W v +   k+ + +vl++GWkeF kan++++gD + F  ++ +++ + 
  AUR62001271-RA 928 KHKLISLKDPAGRDWPVLY--HKRNNLFVLASGWKEFRKANKICTGDECAFVAEKIDKGAFQ 987
                     5679***************..999999************************96644555444 PP

Sequence ? help Back to Top
Protein Sequence    Length: 998 aa     Download sequence    
MSSAVLANRL QTSFMMADYV SPAVYSHVVM GDKGEACAEC SRSCSSFHRT MHDPYPIVSS  60
FFKVMFGNLF SEILFVPPRF AKTVIALEGK YTYLEDPTGQ KWKVNLSNVN GSLAFEKGWH  120
DFSVDHGIEL GDLVVFHYFK GSNFIVQIFG RSGCEKPMIY SGMDYQNKRA KLTRTDPCDS  180
LHNKESTPAK KCLDSGMETG PNVDVHNVEK SPEIRVNVSR EGNINKQPEE VPTADPLVES  240
LFISDKYINC TSEDSRIDLY DLSVFEMPGN KADADKISTL MEYTCSEVPS ALQKNQSEEV  300
SPENFQITET MNETSNEEDA SRKECLPLLN NTVSGAEVPL DIYMPLKSVT LPHAPEFSSP  360
AAPVDEILFT TKGQKVKKED IGSHSTSMGK NKGRIDMIVK LEEPEFCDTP SAQDIKITCL  420
VQQGNESFLE LPKPLPLKIC RQGDSLEQNL VLLRDPLQRL WPVIYHQRKG SEVLANGWKE  480
FRKANCIHPG DECTFVVENI DEGSHFIVEI YGKSGYEKSF PSVKSYQNKR PKTTGDSPSD  540
PSYKEREPSQ KNNCFNTYAV PRSNTYMDDI SWSQDDVNNL NDSPVMEENV QRQVNVIEKP  600
QLVPDVDILV EPCFLNDRET NTAKEANREH LFDLSAFESP GMNPSSSRKG DDDNRFDLSI  660
SNMTSKKLDA REDLGEHLSD QPPFQSFNIE PSFSMNGNRD DISNPSTSKM IDKKVDDHKG  720
NLQGNTCSQV SGAFDEARTR STSIDTKKFP LTQGKTAVPS NNDEANLSSS KHSPVPSVSP  780
ILPSNLMPPP NLFGKKQTCE PSTTSGFSQS PGSNSVCGRE GGTVRVVKQE PREFKQDLSA  840
NLLAGTSFVA SLSFNREAKS NFSGLGVNNP MEDDVEVCKD VKAEPVDFCD SLSVPAGRII  900
CSVPPDNESF LELPEALPIK WRQRLDKKHK LISLKDPAGR DWPVLYHKRN NLFVLASGWK  960
EFRKANKICT GDECAFVAEK IDKGAFQLLI LNRIRCP*
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18960.14e-14B3 family protein