PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AUR62000527-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Atripliceae; Chenopodium
Family B3
Protein Properties Length: 295aa    MW: 33476.9 Da    PI: 10.0203
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AUR62000527-RAgenomePhytozomeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B354.32.5e-176663394
                    -SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
              B3 33 sktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94
                    +++++l+++ g +Wev+l +r + ++ ++++GWkeF+ka++Lke+D ++Fk++++s+f+ +v
  AUR62000527-RA  6 PQMVVLKSPGGSTWEVQL-VRDNNNTLFFKDGWKEFAKAHNLKENDLLMFKYTRDSCFKVWV 66
                    6789**************.56667799*******************************6665 PP

2B343.55.7e-14184272192
                     EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefel 92 
                     f+ vl+ s+v++  rl +p +  +++   k++  +++l+  +g+ W+v+++ + + g+ v+ +GW++F+ +n L+e D+++Fkl++++++  
  AUR62000527-RA 184 FIVVLKDSNVSQYYRLGIPAPWSRTYLTRKHQ--DMKLRA-NGKNWTVRFNAEPRYGGGVFISGWSNFAVDNLLQEFDVCLFKLVSQKDEPV 272
                     7889999*******************755555..677665.9********8877777777778********************998665543 PP

Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    
MWNKLPQMVV LKSPGGSTWE VQLVRDNNNT LFFKDGWKEF AKAHNLKEND LLMFKYTRDS  60
CFKVWVLSGR NLCEVAGSYF VKKSALEKNG AGENSQLKRK NTMVGSAMAT GNKDNSELED  120
SDTERASARA SRRKNRRNST VLRNSGAEEK NRSTDDTLDR VPPSEADKER ALQMANRNLT  180
VESFIVVLKD SNVSQYYRLG IPAPWSRTYL TRKHQDMKLR ANGKNWTVRF NAEPRYGGGV  240
FISGWSNFAV DNLLQEFDVC LFKLVSQKDE PVIFDVSIYR AVPEAAHLPS YKTP*
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G33280.14e-39B3 family protein