PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_023554807.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita; Cucurbita pepo
Family WRKY
Protein Properties Length: 291aa    MW: 32846.4 Da    PI: 8.2082
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_023554807.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.84.7e-33156213259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +Dgy+WrKYGqK vk+s++prsYYrCts++C vkk+vers +dp+vv++tYeg+Hnh+
  XP_023554807.1 156 EDGYRWRKYGQKAVKNSPYPRSYYRCTSQKCLVKKRVERSYQDPSVVITTYEGQHNHH 213
                     8********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    
MSNEEGKNLY QPYDPFHYNQ LDMNRSIFHQ QHPPLDPALM SFTNFLDTSL DYNSLSRAFD  60
VSCSSSEVIS PVDDVSKNKA SCGGKNLNQS STTQNSSVSS SSNEAVVEED SIKSIKEDPK  120
DEEKSKKQNN ISKKKEKRQR EPRFAFLTKS EIDHLEDGYR WRKYGQKAVK NSPYPRSYYR  180
CTSQKCLVKK RVERSYQDPS VVITTYEGQH NHHCPATLRG HSAGIMSSPF YASAASTSLT  240
APSSGPTLPH ELFSHLLPTN SRADPASGMY QNLSLQMPDH YGLLQDLFTQ K
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1135140KEKRQR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18170.12e-48WRKY family protein