PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_023553336.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita; Cucurbita pepo
Family WRKY
Protein Properties Length: 551aa    MW: 60539.3 Da    PI: 7.2713
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_023553336.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1001.5e-31206263260
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                     dDgynWrKYGqK+vkgsefprsYY+Ct+++C+vkk  ers+ d+++++i+Y+g+H+h+k
  XP_023553336.1 206 DDGYNWRKYGQKHVKGSEFPRSYYKCTHPNCEVKKLFERSH-DGQITDIVYKGTHDHPK 263
                     8****************************************.***************85 PP

2WRKY105.33.2e-33377435159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+v+g+++prsYY+Ct  gCpv+k+ver+++dpk+v++tYeg+Hnh+
  XP_023553336.1 377 LDDGYRWRKYGQKVVRGNPNPRSYYKCTNVGCPVRKHVERASHDPKAVITTYEGKHNHD 435
                     59********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 551 aa     Download sequence    
MDPTEPASTA AAGAKYKLMS PAKLPIFRSP CITIPPGLSP SSFLDSPVLL TNFKVEPSPT  60
TGSFTKLPMA HDSSSSAIYP MTTMACSNAN ASDEGNSNYF EFKPYVGPNM VPADMSHRKD  120
EQSCELQVQG QPQPFTAPPM TKSEINVISN DSNRSTQMDP VASGAAVPDI DGDDFNHSLN  180
TNTRAQAAQS DPKGSGSPVV SDRISDDGYN WRKYGQKHVK GSEFPRSYYK CTHPNCEVKK  240
LFERSHDGQI TDIVYKGTHD HPKLQPSRRY SASASVKDGP DKPSPLTGQD DRSCSIYTRT  300
VHSIEPNGTP ERLAANDSNT EGAGTTLPCK NPDELDDNDI ILKRRKMELG GFEACPMVRP  360
IREPRVVVQT LSEVDILDDG YRWRKYGQKV VRGNPNPRSY YKCTNVGCPV RKHVERASHD  420
PKAVITTYEG KHNHDVPTAK TSSHDAAGPL RTAPLRYRLE DRDTVSLDLG VGIGENRSNE  480
YRQQALAPNG NFNFEVVQEN SAPTYFSVHN RGMNQHGPRE SLSESRSVDV VPLNHSSHPY  540
PPSVGRILTG P
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.21e-174WRKY family protein