PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_023553325.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita; Cucurbita pepo
Family WRKY
Protein Properties Length: 700aa    MW: 76415.3 Da    PI: 6.5113
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_023553325.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY100.69.6e-32303359259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +DgynWrKYGqK+vkgse+prsYY+Ct+++C+vkkkvers+ +++++ei+Y+g+Hnh 
  XP_023553325.1 303 EDGYNWRKYGQKQVKGSEYPRSYYKCTHPNCQVKKKVERSH-EGHITEIIYKGTHNHV 359
                     7****************************************.***************6 PP

2WRKY103.21.4e-32493551159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+vkg+++prsYY+Ct +gC+v+k+ver+++d k v++tYeg+Hnh+
  XP_023553325.1 493 LDDGYRWRKYGQKVVKGNPNPRSYYKCTNPGCTVRKHVERASHDLKSVITTYEGKHNHD 551
                     59********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 700 aa     Download sequence    
MGRNDDNVAI IGDWVPPSPS PRTFFSAMQM LEEDVAGSRP TDKPEKLFLG SREHTVTEND  60
IARGGIPGVN SGDRSTEFGT VSEQKRGGLV ERIAARAGFN APRLNTENIR STEEVKSPYL  120
TIPPGLSPTT LLDSPVFLSN SLAQQSPTTG KFPFVANVSY RSSTMMLEAN NRGNDNPFDD  180
NSSSFAFRPS VESGSFFHGA ASKVISLPQS CPRIEVPGLR SENSYQPENR INHHPQMGLS  240
MSCTERDDGG KNVLDDQRPF DSVCGSGGGG GEHSSPLDEQ PDEGEQRGTG DSMAGGGCGA  300
PSEDGYNWRK YGQKQVKGSE YPRSYYKCTH PNCQVKKKVE RSHEGHITEI IYKGTHNHVK  360
PSPNRRASDS HINMQQAGQQ NAEVPLWEDS QKGTPDWMHS NLEVSSSASL GPEYGNHIET  420
VEAIDASSTF SNDEDEDDRG THGSITMGYE GEGDESESKK RKLDAYVTEM SGATRAIREP  480
RVVVQTTSEV DILDDGYRWR KYGQKVVKGN PNPRSYYKCT NPGCTVRKHV ERASHDLKSV  540
ITTYEGKHNH DVPAARNSSH ISSCTSSPVT GQNSTTTHAH RPGPPQSQNN MPRFERPAFG  600
LAGRQPMGTA HAHGFGFGMN QPGLRNLNLT MTMASAGQAK LPVLPMHPYL AQAHNVHEMG  660
LLLPKGEPNL EPTSDLGFNF SNGSTAYQQI MSRLPLGPEM
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56270.11e-180WRKY family protein