PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_023546080.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita; Cucurbita pepo
Family WRKY
Protein Properties Length: 300aa    MW: 33089.5 Da    PI: 7.1593
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_023546080.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1017e-32141198259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +Dgy+WrKYGqK vk s+fprsYYrCt ++C+vkk+vers+edp+vv++tYeg+H h+
  XP_023546080.1 141 EDGYRWRKYGQKAVKYSPFPRSYYRCTNSKCTVKKRVERSSEDPSVVITTYEGQHCHH 198
                     8******************************************************997 PP

Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    
MDPSHNPDSP PSFSTADSST VWTNALPSAD SFYFFPADRD SAVLTEFGWN FLSHDAQPTR  60
FLDDKPDLPG TSALAVDETG GLQSPDAPVP VASNPSMSSS SSGEPPEKLP EIPQKVKKKG  120
QKRIRQPRFA FMTKSEVDHL EDGYRWRKYG QKAVKYSPFP RSYYRCTNSK CTVKKRVERS  180
SEDPSVVITT YEGQHCHHTV GFPRGGLNMA HKAAFGSQFS PQGAHIYYHE TQPLPRNNNN  240
NNDTPTARDH HSQHLSTAAA SSSSNALSLE QQEPTNSQPQ VASDEGLLGD IVPPGMMRRT
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69310.23e-63WRKY family protein