PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_023544946.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita; Cucurbita pepo
Family WRKY
Protein Properties Length: 296aa    MW: 33056 Da    PI: 6.7864
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_023544946.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.16.6e-32129185258
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                     dDgy+WrKYGqK++k+s++prsYYrC+ ++C++kk+vers edp++++itYeg H h
  XP_023544946.1 129 DDGYKWRKYGQKSIKNSPNPRSYYRCSNPRCSAKKQVERSIEDPDTFVITYEGLHLH 185
                     8******************************************************99 PP

Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    
MESLAAIPWS DIYNNISDDH LLSLTDLLHH DDDNDNDTAA SPLFLVPQVA YSDRATMLPV  60
PGSTAYFGPT IGAVENALSI TPRSRNLQSN THIPRTTAGS SIRERVTVNN VEHKYSIRIK  120
SCDGNSLADD GYKWRKYGQK SIKNSPNPRS YYRCSNPRCS AKKQVERSIE DPDTFVITYE  180
GLHLHFAYPF FLMGQSPQDQ SPTKKPKMLG PEMEAHKRPT FITPGPLPPD NPKEATGPQG  240
LLEDVVPWMI RNPSANHDTL SNSSFCSSYR SPPMSPPSPS TCPTFAPSYF SYFWEI
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43290.17e-44WRKY family protein