PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_023544832.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita; Cucurbita pepo
Family WRKY
Protein Properties Length: 219aa    MW: 25020.3 Da    PI: 9.0135
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_023544832.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.62.2e-32142200159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+vk++ +prsYYrCt ++C+vkk+ver aedp++v++tYeg+H h+
  XP_023544832.1 142 LDDGYKWRKYGQKVVKNTLHPRSYYRCTEENCKVKKRVERLAEDPRMVITTYEGRHAHS 200
                     59********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    
MGSSASEEDI IMATLLQAEQ AAAAITTNFA SFPENINNLV QQTLKPFLFF KADDQYSLQQ  60
QQQQQSVFPF PFPFPSTTAT ATSHLLSSLR DAGESGNHGD CDGDNRKGGL RVRTVKMKRM  120
KGRRKVREPR FCFKTMTDVD VLDDGYKWRK YGQKVVKNTL HPRSYYRCTE ENCKVKKRVE  180
RLAEDPRMVI TTYEGRHAHS PSDRNLEDTN MGCLNTFFC
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39410.11e-45WRKY family protein