PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_023544762.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita; Cucurbita pepo
Family WRKY
Protein Properties Length: 266aa    MW: 29477.6 Da    PI: 5.4493
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_023544762.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.72.4e-33119176259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +Dgy+WrKYGqK vk+s +prsYYrCt+++C vkk+vers edp++v++tYeg+Hnh+
  XP_023544762.1 119 EDGYRWRKYGQKAVKNSAYPRSYYRCTTQKCGVKKRVERSYEDPSIVITTYEGQHNHP 176
                     8********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    
MSDEMFKDLF LSSPFGYGGL GDSETGLDEY ESLARAFELS SDYSNEISGT PMNSSASFSS  60
SDAGADEDDS LKDKDKQIKD MDDGGESSKT AAKSKKKVEK KEREPRVAFM TKSEVDHLED  120
GYRWRKYGQK AVKNSAYPRS YYRCTTQKCG VKKRVERSYE DPSIVITTYE GQHNHPIPAT  180
LRGNLSAVSG AFPPSMLAPM PVVGGVRYLP QLMNNTSVNN NQPIGGGDTV YSQSSSFNYP  240
YNGRQQDYGL LQDIFPTAPP FLNRQP
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29860.13e-57WRKY family protein