PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_023544319.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita; Cucurbita pepo
Family WRKY
Protein Properties Length: 183aa    MW: 20305.8 Da    PI: 8.1386
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_023544319.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.13.3e-32104162159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK vk s++prsYYrCt+++C+vkk+++r ++dp++v++tYeg Hnh+
  XP_023544319.1 104 LDDGYRWRKYGQKAVKHSTHPRSYYRCTHHTCNVKKQIQRHSKDPTIVVTTYEGIHNHP 162
                     59********************************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    
MVMDGDIHNS HDMASSSTVN YQSSDAAAEI DWVGIFGGSS DVSLEMEKGS GVSEGAIMAM  60
GDCNYQNESH VHVHGGKNKG KMAMGKRGAI PRVAFQTRSA EDVLDDGYRW RKYGQKAVKH  120
STHPRSYYRC THHTCNVKKQ IQRHSKDPTI VVTTYEGIHN HPSEKLMETL TPLLKQLQFL  180
SGI
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41570.16e-57WRKY family protein