PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_023543092.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita; Cucurbita pepo
Family WRKY
Protein Properties Length: 163aa    MW: 18547.6 Da    PI: 8.4531
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_023543092.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY91.56.6e-2998156159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDg++WrKYG+K+vk++ +pr+YY+C+s gC vkk+ver+++d ++v++tYeg Hnh 
  XP_023543092.1  98 LDDGFKWRKYGKKSVKNTSHPRNYYKCSSGGCGVKKRVERDRDDSSYVITTYEGIHNHA 156
                     59********************************************************6 PP

Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    
MNPLQNPSFF LDYHQFQDSS FSFMDLFDVS SYPLPDFGLE AETTASLLTE ARTGAERRST  60
EATSIDNNSM QVEKRKKERG GGCNNRVAFR TKLVSDILDD GFKWRKYGKK SVKNTSHPRN  120
YYKCSSGGCG VKKRVERDRD DSSYVITTYE GIHNHASPFS DMV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
174113KRKKERGGGCNNRVAFRTKLVSDILDDGFKWRKYGKKSVK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64810.12e-40WRKY family protein