PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_023541899.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita; Cucurbita pepo
Family WRKY
Protein Properties Length: 468aa    MW: 50983.6 Da    PI: 8.4361
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_023541899.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY106.61.2e-33200256259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     dDgynWrKYGqK+vkgsefprsYY+Ct+++Cpvkkkvers  +++++ei+Y+geHnhe
  XP_023541899.1 200 DDGYNWRKYGQKQVKGSEFPRSYYKCTYPNCPVKKKVERSL-EGHITEIIYKGEHNHE 256
                     8****************************************.***************8 PP

2WRKY104.65.2e-33378436159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+vkg+++prsYY+Ct+ gC+v+k+ver+++d+k+v++tYeg+Hnh+
  XP_023541899.1 378 LDDGYRWRKYGQKTVKGNPYPRSYYKCTTLGCNVRKHVERASTDQKAVITTYEGKHNHD 436
                     59********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 468 aa     Download sequence    
MGDDEDKLPP SSVPSPLKSK AFPLRPTINL PPRTSMESLL SGGPGLGLGF SPGPMTLVSS  60
FFSDSDDCKS FSQLLAGAMT SPVAVPPTAS ELKDSAGLPD SPGLFSPDQG TFGLTHQQAL  120
AQVTLQAVEA YSHKQIQAHS VAGSAASSKL LTVFPSEKAK DQPVPLQLLN SAVASKESSD  180
ISQSDQRSVS SSCNVDRPAD DGYNWRKYGQ KQVKGSEFPR SYYKCTYPNC PVKKKVERSL  240
EGHITEIIYK GEHNHERPQP NKRAKDVGNS NGCSSVHGNT DLYSQVKSGY LNKLNEQSAV  300
SSVVKKDRES NLVKHGQLLD ASDSEGAGEI ETGPNKNDED EPDAKRRNTE ARVEPVSSHR  360
TLTESRIIVQ TTSEVDLLDD GYRWRKYGQK TVKGNPYPRS YYKCTTLGCN VRKHVERAST  420
DQKAVITTYE GKHNHDVPAG KISSHGTANS NVPRLKSQNI GTEKDFYR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03340.11e-114WRKY family protein