PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_023540444.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita; Cucurbita pepo
Family WRKY
Protein Properties Length: 578aa    MW: 63628.5 Da    PI: 6.7964
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_023540444.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY100.78.5e-32222279260
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                     dDgynWrKYGqK+vkgsefprsYY+Ct+++C+vkk  ers+ d+++v+i+Y+g+H+h+k
  XP_023540444.1 222 DDGYNWRKYGQKHVKGSEFPRSYYKCTHPNCEVKKLFERSH-DGQIVDIIYKGTHDHPK 279
                     8****************************************.***************85 PP

2WRKY105.23.4e-33397455159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+v+g+++prsYY+Ct  gCpv+k+ver+++dpk+v++tYeg+Hnh+
  XP_023540444.1 397 LDDGYRWRKYGQKVVRGNPNPRSYYKCTNVGCPVRKHVERASHDPKAVITTYEGKHNHD 455
                     59********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 578 aa     Download sequence    
MDPTDADLAD PSHVRLSVSS EPSSASAAGA KYKLLSPAKL PISRSPCITI PPGLSPTSFL  60
ESPVLLTNLK VEPSPTTGSF TKLPMAHDSS SSAIYSMTTM AFSNTHASDE GRSSYFEFKP  120
YAGPNMVPAD LSHRKGEQSR EVQVQGQPQP FTAPPMTKSE INVNSNDLSR SIQMDTVASR  180
ASVPEVDGDD FNHSLNTNTR VQPQQSDPKA SGIQVVSDRL SDDGYNWRKY GQKHVKGSEF  240
PRSYYKCTHP NCEVKKLFER SHDGQIVDII YKGTHDHPKP QPSRRYSASA SMNVQEDGPD  300
KPSPLTGQDD RSCVIYARAV RTIEPNGTPE PSHAANDSMA EGVGTTLPPR SHDEVDDDDI  360
FSKRRKMELG GFDVCPMVKP IREPRVVVQT LSEVDILDDG YRWRKYGQKV VRGNPNPRSY  420
YKCTNVGCPV RKHVERASHD PKAVITTYEG KHNHDVPTAK TSSHEVQGSL TIAPSRYRLE  480
ESDTISLDLG VGIGAGGENR SNEYRQAFHS QLAENQNPNG NFNFEIVQEN SPPAYFGVLD  540
RGISQHGSRE SLSESRTMSL NHSSHPYPPS IERILTGP
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.20.0WRKY family protein