PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_023540261.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita; Cucurbita pepo
Family WRKY
Protein Properties Length: 323aa    MW: 35503.5 Da    PI: 6.9351
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_023540261.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.27.1e-33163221159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK vk+s++prsYYrCt+++C vkk+vers++d ++v++tYeg+H+h+
  XP_023540261.1 163 LDDGYRWRKYGQKAVKNSPYPRSYYRCTTSQCGVKKRVERSSSDHSIVITTYEGQHTHQ 221
                     59********************************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    
MEKKFEDSLM GSATSTGIYS QTVFSDEFPV GGSGFSGVFD LPCDDDHKAS CCSSSSFDLF  60
GGGIGFHDFY NPSSMFDLLS TTAPPLQPPL SSPSSTVPES SEVLNAPTTP NSSSVSNSSS  120
NEASPIEEVD KNKTSKMLKP KKNQKKQRER RFAFMTKSDI DHLDDGYRWR KYGQKAVKNS  180
PYPRSYYRCT TSQCGVKKRV ERSSSDHSIV ITTYEGQHTH QSPVMPRGSI RILSESTNCL  240
VADHDVATTG ILFQHNVPGQ PFMYNPLQPF LTNDSSFLSP RPPPSSVPPP SLSSRASLLQ  300
DNGLLQDLVP LQVRKEPKDE QNG
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49520.11e-46WRKY family protein