PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_023539084.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita; Cucurbita pepo
Family WRKY
Protein Properties Length: 201aa    MW: 22556.3 Da    PI: 9.8799
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_023539084.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY100.51e-31122180159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK vk+++fprsYY+Ct++gC+vkk+v+r ++d+ vv++tYeg H h+
  XP_023539084.1 122 LDDGYRWRKYGQKGVKNNKFPRSYYKCTHQGCKVKKQVQRLTRDEGVVVTTYEGIHSHP 180
                     59********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    
MMESYPDFLS ASSSSTSLSF QKMLISRASE PTGIHGSQFR EAAISGGFPL FPDVSGSYMS  60
VGTRSSTKED MVSVSKGSAV EVVEGGAETT EMTAARQGDN DKKKKTRSRR FAFQTRSQVD  120
ILDDGYRWRK YGQKGVKNNK FPRSYYKCTH QGCKVKKQVQ RLTRDEGVVV TTYEGIHSHP  180
IQKSTDNFEH ILTQMQIYTS Y
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.14e-57WRKY family protein