PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_023538960.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita; Cucurbita pepo
Family WRKY
Protein Properties Length: 226aa    MW: 25619.3 Da    PI: 8.3825
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_023538960.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.41.2e-32152210159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+vk+s +prsYYrCt+++C+vkk+ver +ed ++v++tYeg+Hnh+
  XP_023538960.1 152 LDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHS 210
                     59********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    
MEGSQRSELP NYQLQVSFLS NAPNPQPIHE MGFLHFEDHN QVLSFVAPNN NAATPTTAPP  60
TTTTTTTTTT AMPSAFTTPP HAHLLTRPSW SNDQVGTLDP KPGGDENCTG STSDGTNSWW  120
RNSNADKTKV KVRRKLREPR FCFQTRSDVD VLDDGYKWRK YGQKVVKNSL HPRSYYRCTH  180
SNCRVKKRVE RLSEDCRMVI TTYEGRHNHS PCDDSNSSDH EPFTSF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1131137KVRRKLR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G44745.16e-66WRKY family protein