PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_023537438.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita; Cucurbita pepo
Family WRKY
Protein Properties Length: 145aa    MW: 16777.5 Da    PI: 5.0433
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_023537438.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY100.51e-3185143159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDg++WrKYG+K+vk+s++pr+YY+C+ +gCpvkk+ver+++dpk+v++tYeg H+he
  XP_023537438.1  85 LDDGFKWRKYGKKMVKNSPNPRNYYKCSVEGCPVKKRVERDRDDPKYVITTYEGVHTHE 143
                     59********************************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 145 aa     Download sequence    
MSYNSNQYPA TSESDLAEQP GIEFTDSMFN GWLDVNASSL VDTVMYPGYQ WDEVDELARN  60
TIHQGEPSSV RERFAFKTKS EVEILDDGFK WRKYGKKMVK NSPNPRNYYK CSVEGCPVKK  120
RVERDRDDPK YVITTYEGVH THESS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26170.16e-45WRKY family protein