PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_023537046.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita; Cucurbita pepo
Family WRKY
Protein Properties Length: 282aa    MW: 31010.2 Da    PI: 6.4009
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_023537046.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1048.2e-33142199259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +Dgy+WrKYGqK vk+s+fprsYYrCt ++C+vkk+vers++dp+vv++tYeg+H h+
  XP_023537046.1 142 EDGYRWRKYGQKAVKNSPFPRSYYRCTNSKCTVKKRVERSSDDPTVVITTYEGQHCHH 199
                     8******************************************************997 PP

Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    
MDRDPPPNFS TADSSTNWTS SSLASASVDA DYLLSGDRET TILTEFGWNF DSDEVQPSRF  60
LDSDQIATDD NADFAGTSTG SLQSPDVPVP LASNPSLSSS SSGEPPEKQP EIPRNKVKKK  120
GQKRIRQPRF AFMTKSEVDH LEDGYRWRKY GQKAVKNSPF PRSYYRCTNS KCTVKKRVER  180
SSDDPTVVIT TYEGQHCHHT VGFPRGGGLN MAHEPAFGTQ FSPHMAQFFY PEPHPPPTVT  240
PPNAPNLPSV APSQEQPPNS SPQVASDEGL LGDVVAPGMR RR
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69310.27e-62WRKY family protein