PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_023534752.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita; Cucurbita pepo
Family WRKY
Protein Properties Length: 447aa    MW: 49295.4 Da    PI: 8.5686
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_023534752.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.45.2e-32173230260
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                     dDgynWrKYGqK vkgse+prsYY+Ct+++Cpv+k+ve+s  +++++ei+Y+++Hnh+k
  XP_023534752.1 173 DDGYNWRKYGQKLVKGSENPRSYYKCTHPTCPVRKQVEKSL-NGQITEIVYKSKHNHPK 230
                     8****************************************.***************85 PP

2WRKY101.16.4e-32325383159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy WrKYGqK+vkg+++prsYY+Ct+agC v+k++er+++d k+v++tYeg+Hnhe
  XP_023534752.1 325 LDDGYWWRKYGQKVVKGNPNPRSYYKCTYAGCGVRKHIERASHDLKAVITTYEGKHNHE 383
                     59********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 447 aa     Download sequence    
MVMEFFFSSR VEEDPTDGRP RLPESTAPPI SSKFSSTPNP NPPLLSAMSQ PLFSPSSFFT  60
IPPGISPTQL LDSPVLLTSS NFQASPTTGA ISTGHHQKNM KQEQHNLAEF SFPRTNPTKS  120
SSSSSIMFQS SSMQQNPPWV SQAAFNFPPE TTVNGGSKSD QHPQSQPKNR TSDDGYNWRK  180
YGQKLVKGSE NPRSYYKCTH PTCPVRKQVE KSLNGQITEI VYKSKHNHPK PEFPRRSSSA  240
SSSSSSWLSQ ALPQTMAAEP KHSMASDSIP TPENSSTTIG DDDSDELDAK RWKSESENEI  300
ISVAGGKTVR EQRVVVQTIS RVDKLDDGYW WRKYGQKVVK GNPNPRSYYK CTYAGCGVRK  360
HIERASHDLK AVITTYEGKH NHEIPAARGG GSRPVSNNHG NDNGHASNGA GDVWPSSEIS  420
GGDDGFSNML WRTKEEAADE IFRSLLD
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.12e-86WRKY family protein