PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_023533099.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita; Cucurbita pepo
Family WRKY
Protein Properties Length: 209aa    MW: 24581.6 Da    PI: 9.6041
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_023533099.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.16.4e-32132190159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+vk++++prsYYrCt+ +C+vkk+ver +edp++v++tYeg+H h+
  XP_023533099.1 132 LDDGYKWRKYGQKVVKNTHHPRSYYRCTQDDCRVKKRVERLDEDPRMVITTYEGRHIHS 190
                     59********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 209 aa     Download sequence    
MGSKSQILLN PQALFEDEEH EEASTQHQME FFSFPSNFNV SHLPSIPQHQ TLSPSTPFLH  60
PNLSQTLNSS HFPTPHLLSL QTSTPNPWAF GKRNEYHLGL GVSTMKMKRM KGRRKVREPR  120
FSFKTMTDVD VLDDGYKWRK YGQKVVKNTH HPRSYYRCTQ DDCRVKKRVE RLDEDPRMVI  180
TTYEGRHIHS PSHDTQHSEP HTHLNNFFW
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39410.16e-49WRKY family protein