PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_023530656.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita; Cucurbita pepo
Family WRKY
Protein Properties Length: 502aa    MW: 54806.9 Da    PI: 6.4558
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_023530656.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY76.72.7e-24191247259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +DgynWrKYGqK+vk  + +rsYY+Ct++gC++kk +e++++ + v+e++Y+++Hnh+
  XP_023530656.1 191 SDGYNWRKYGQKQVKIPKGSRSYYKCTYSGCCAKK-IECCDHSGLVTEVVYKSQHNHD 247
                     7********************************98.*********************7 PP

2WRKY99.71.9e-31365421359
                     -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     Dgy+WrKYGqK+vkg+++pr+YYrCtsagCpv+k++e + e+p+vv+itY+g H+h+
  XP_023530656.1 365 DGYRWRKYGQKMVKGNPHPRNYYRCTSAGCPVRKHIESAVENPSVVIITYKGVHDHD 421
                     9*******************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 502 aa     Download sequence    
MAEPEGFDSN QLGTSKASAE QQDDEEEEME DSENESEVEL EEHKLSELRT ASSVSEAAVK  60
GSCSQTLAPP SANQSSENGR SDGLPDNSAA ESLEGVELKH QAPPASNVEA IQTDQVQEQS  120
QLQIIVYKGP DSEQSPTSVT QSISSSASPS LSEYKLAPKK VHKECKPEPS QKNSSDRKTV  180
FSVPNVRTPA SDGYNWRKYG QKQVKIPKGS RSYYKCTYSG CCAKKIECCD HSGLVTEVVY  240
KSQHNHDPPR KISNPKESVL VPYVEPVVKK IMAEHSVRII NDSDPPMSSK EPLWETASVV  300
ERKRQFSNDS DGNDESKIKN ENDNEYETKQ KVKKSSGGYS GTPLKPGKKP KFVVHAAGDV  360
GISGDGYRWR KYGQKMVKGN PHPRNYYRCT SAGCPVRKHI ESAVENPSVV IITYKGVHDH  420
DMPVPKKRHG PPSAPLVAAA APASMGNMQP KKTDAVQSQI SSTQWSVDAE GELTGEALDL  480
GGEKAMESAR TLLSIGFEIK PC
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.11e-119WRKY family protein