PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_023530498.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita; Cucurbita pepo
Family WRKY
Protein Properties Length: 274aa    MW: 31222.8 Da    PI: 8.1967
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_023530498.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.74.3e-32139196259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +Dgy+WrKYGqK vk+s++prsYYrCts++C vkk+vers +dp++v++tYeg+H h+
  XP_023530498.1 139 EDGYRWRKYGQKAVKNSPYPRSYYRCTSQKCVVKKRVERSYQDPSLVITTYEGQHIHH 196
                     8*******************************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    
MANDEGENKV YQQYDPFVYN QLDMNRTILQ QQPSLDPAFM SFTNFIDTSL EYNSVWRPLD  60
VSCSSSELIS PVDDMSKKKA SNASVSSSSD EAAPAAEDDS VKSKKEEKRK KQNAAQKKEK  120
REREPRFAFL TKSEIDQLED GYRWRKYGQK AVKNSPYPRS YYRCTSQKCV VKKRVERSYQ  180
DPSLVITTYE GQHIHHCPAT LRGHSSPFYA SASTSTLATA PSSGPALPQE LFSHLLSKNC  240
QTDPTSMVYQ NPNLQQHLQM SDHHSLLQDL FTQK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29860.11e-45WRKY family protein