PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_023529685.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita; Cucurbita pepo
Family WRKY
Protein Properties Length: 425aa    MW: 47126 Da    PI: 6.4651
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_023529685.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY92.92.5e-29110166259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +DgynWrKYGqK vkg+ f rsYYrCt+++C+vkk++er++ d+k+++i+Y g H+h+
  XP_023529685.1 110 EDGYNWRKYGQKLVKGNVFVRSYYRCTHPTCMVKKQLERTH-DGKITDIIYFGPHDHP 166
                     7***************************************9.***************8 PP

2WRKY106.61.3e-33282340159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ++Dgy+WrKYGqK vkg+++prsYYrC+s+gCpvkk+ver+++dpkvv +tYeg+H+h+
  XP_023529685.1 282 VNDGYRWRKYGQKLVKGNPNPRSYYRCSSPGCPVKKHVERASHDPKVVLTTYEGHHDHD 340
                     58********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 425 aa     Download sequence    
MVSSGDQIET KVDSDRLEHE QSSFSQAQAS QEDPGGTNAS NSDHKNTAAS RETLEEAVKQ  60
PDVTIPLVDR GDISNTVAEK VTQNPIHADQ DSHPDLKVSI TSTIREKVSE DGYNWRKYGQ  120
KLVKGNVFVR SYYRCTHPTC MVKKQLERTH DGKITDIIYF GPHDHPRPQP HIPVAVGVVN  180
MVEEKLDDHA SRSSQDKPST ALGQTPRKTE PGDALQLSLD MANDKEKDEA SKRSRINDEV  240
DSDDTRDLKR EKKICNIDVT VADKSTVESR VVVQTPSEVD IVNDGYRWRK YGQKLVKGNP  300
NPRSYYRCSS PGCPVKKHVE RASHDPKVVL TTYEGHHDHD MPPARTVTLN SAGSTAAHSD  360
EMKTKTVGSS IGQDTVVHAN KDPPSNSSSE DKLIETNGKS NATEASDRIV LDMVVYQARS  420
FECSK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G04880.27e-93WRKY family protein