PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_023528631.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita; Cucurbita pepo
Family WRKY
Protein Properties Length: 294aa    MW: 32133.9 Da    PI: 8.9308
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_023528631.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY100.78.9e-32136194159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK vk+s++prsYYrCt+ gC vkk+ver ++d ++v++tYeg+H+h+
  XP_023528631.1 136 LDDGYRWRKYGQKAVKNSPYPRSYYRCTTVGCGVKKRVERLSNDHSTVVTTYEGKHTHQ 194
                     59********************************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    
MMGSENSAGK YSPVGFSDDF SATSFGSSNS FDLLGSGIDF YNPLSSLFDL VSTTAPLLSS  60
PASTVPESSE VVNAPPTPNS SSVSSYSNDA AAIDEVDKNN TEKPSSSNVL KPKKKNPKKQ  120
REPRFAFMTK SDIDHLDDGY RWRKYGQKAV KNSPYPRSYY RCTTVGCGVK KRVERLSNDH  180
STVVTTYEGK HTHQSPIMPR GSIRILPESN LDVTTTTGLL FQPNTPQPFM YSPPPPFLTI  240
NSLSTNPRPP SSFPPPPPPP PPPSSQASVL RDHGLLQDLV PLQMRKEPKD EQNG
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49520.12e-48WRKY family protein