PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_023528217.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita; Cucurbita pepo
Family WRKY
Protein Properties Length: 172aa    MW: 19280.6 Da    PI: 9.5443
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_023528217.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.17.3e-3392150159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK vk+++fprsYYrCt++gC+vkk+v+r ++d+ vv++tYeg H+h+
  XP_023528217.1  92 LDDGYRWRKYGQKAVKNNKFPRSYYRCTHQGCNVKKQVQRLTRDEGVVVTTYEGMHTHS 150
                     59********************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    
MENYQMFFPC SNGGGLSAFS QPDISSGTAS DMFRNFHGGD PQASGVLGLK TEVVTAAVEA  60
DGNCGGSGNK KGEKKVRKPR YAFQTRSQVD ILDDGYRWRK YGQKAVKNNK FPRSYYRCTH  120
QGCNVKKQVQ RLTRDEGVVV TTYEGMHTHS IDKPTDNFEQ ILSRMQIYST PF
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.11e-54WRKY family protein