PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_023528127.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita; Cucurbita pepo
Family WRKY
Protein Properties Length: 299aa    MW: 33409 Da    PI: 9.359
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_023528127.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY107.85.2e-34137194259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +Dgy+WrKYGqK vk+s+fprsYYrCt+++C+vkk+ver+++dp+++++tYeg+H+h+
  XP_023528127.1 137 EDGYRWRKYGQKAVKNSPFPRSYYRCTTPTCNVKKRVERCSNDPTILVTTYEGQHTHP 194
                     8********************************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    
MEEVKKKKKE EIIKSEDPST SGGGGGGIFP FSDKMRLNGF FDFPDGEKCS VGFLEMLGLN  60
NHEFKGNSSQ VLNPPATPNR SSSVSSASTD AVIDNPQQQQ QNPTKKSKKK VKKKKKEKRE  120
KEGRFAFMTK SEVDHLEDGY RWRKYGQKAV KNSPFPRSYY RCTTPTCNVK KRVERCSNDP  180
TILVTTYEGQ HTHPTPILLP PPLSTPPCIH LPPMPCLPPT NNNHDGDIIG AMCDEYTQNP  240
AFLNSQHLEA NYTINNLIGA RKAAAGMLQQ KRLCNPNATF LVDHGLLQDV IPAHMLKQE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1105113KKSKKKVKK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G62340.14e-38WRKY family protein