PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_023527637.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita; Cucurbita pepo
Family WRKY
Protein Properties Length: 462aa    MW: 51069.3 Da    PI: 9.413
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_023527637.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.74.3e-32197253360
                     -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
            WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                     DgynWrKYGqK+vkgs++prsYY+Ct+++Cpvkkkvers  d+k+ ei+Y+geH+h+k
  XP_023527637.1 197 DGYNWRKYGQKQVKGSKYPRSYYKCTHPSCPVKKKVERSL-DGKIAEIVYKGEHDHPK 253
                     9***************************************.***************85 PP

2WRKY89.92.1e-28393448459
                     SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   4 gynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     g +WrKYGqK+vkg+ +prsYYrCt  +C+++k ver++edp+ +++tYeg+Hnh+
  XP_023527637.1 393 GIRWRKYGQKVVKGNLYPRSYYRCTGLKCKARKYVERASEDPDSFITTYEGKHNHD 448
                     679****************************************************7 PP

Sequence ? help Back to Top
Protein Sequence    Length: 462 aa     Download sequence    
MDNKAVERVV IARPVASRPT CSSFKSFSDI LACAFNSSPP NMTSETTKVA AIRPKTVRFK  60
LKNNPAPSPM AKILETAPQT ISRSSSDNLA ISDSKTTVLF KPLAKHVSKR TVSQLSHIGN  120
TNLQNSLPHP PDKDSIQCPN QGKDNVQSAL TSNLPQNITS TVENSQSIES SRVTLNYSKE  180
DPTLLHSQVS CAQPSYDGYN WRKYGQKQVK GSKYPRSYYK CTHPSCPVKK KVERSLDGKI  240
AEIVYKGEHD HPKPQPLKLN SSGTQGEGSI SNGTVRDTNP ELWLYYLNGQ IEGSESQLEN  300
HIEKTCQGRV TLPFDPVVVR EVHGGCRISD NSCGLSVECE EGSKGLESTG DKLRSKRRGG  360
KNPTNEADIS IEGVYEHHAM ARGSTDIEIS GKGIRWRKYG QKVVKGNLYP RSYYRCTGLK  420
CKARKYVERA SEDPDSFITT YEGKHNHDIS LGNANHVAPQ ME
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37260.12e-92WRKY family protein