PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_023527525.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita; Cucurbita pepo
Family WRKY
Protein Properties Length: 475aa    MW: 51766 Da    PI: 7.8295
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_023527525.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.43.1e-33169225259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +DgynWrKYGqK+vkgse+prsYY+Ct+++Cp+kkkvers  d++++ei+Y+g+Hnh 
  XP_023527525.1 169 NDGYNWRKYGQKQVKGSENPRSYYKCTFPNCPTKKKVERSL-DGQITEIVYKGSHNHA 225
                     7****************************************.***************7 PP

2WRKY105.43e-33318375259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      Dgy+WrKYGqK+vkg+++prsYY+Cts gCpv+k++er+a+d ++v++tYeg+Hnhe
  XP_023527525.1 318 PDGYRWRKYGQKVVKGNPNPRSYYKCTSLGCPVRKHIERAANDMRAVITTYEGKHNHE 375
                     6********************************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 475 aa     Download sequence    
MNNINQSVNT VAGGSCEKRT NGLGMEAPKF KSLQPPPFPM SPSSYLSAFS SGLSPTELLN  60
SPLFSFGLFP SPTTASFNFR NDYDDADHQE MKADVKNYSN SSFNPQTRSS VSSYFQSSSS  120
NVTPLNPGGL SCDESGAKSE VVATDMAAAQ SNPVSQLPVY SREQKKSEND GYNWRKYGQK  180
QVKGSENPRS YYKCTFPNCP TKKKVERSLD GQITEIVYKG SHNHAKPQPT RRSGNSAVYD  240
PSAAESTLLR EDSSVSVGDD EVEPNSPFSN SVDDNENEPE SKRWKGENEN EGFSGGGSRT  300
VKEPRIVVQT TSEIDILPDG YRWRKYGQKV VKGNPNPRSY YKCTSLGCPV RKHIERAAND  360
MRAVITTYEG KHNHEVPAAR GGGGSFYNAV NRPVPANIPM PVRPSAAVSH SFPTNFPATF  420
LAGNINMSEI GARAASSSFP FQTSQGVPPS FQVSGFGTAA KEEAEDNMFF NSFLS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.11e-109WRKY family protein