PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_023523750.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita; Cucurbita pepo
Family WRKY
Protein Properties Length: 303aa    MW: 33552.7 Da    PI: 8.9434
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_023523750.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY94.67.1e-30159218159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-ST.T---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsa.gCpvkkkversaedpkvveitYegeHnhe 59 
                     ++Dgy+WrKYGqK+ +++++pr+Y++C++a +Cpvkkkv+rs ed+++++ tYegeHnh+
  XP_023523750.1 159 VKDGYQWRKYGQKVTRDNPCPRAYFKCSFApTCPVKKKVQRSVEDQSILVATYEGEHNHP 218
                     58***************************99****************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    
MASSYSSWLD SVDTSLDLNL HPLRFTGEAP VTKERNYLDH EKVSVKEETG ALMEELKRVS  60
AENKKLTEML TVVCENYNTL RGHLVDQMNK NGEKEVFCSK KRKSESSNNN NMVGINGNSE  120
SSSTDEESYK KPKQETINKS SKTTRVQVKI GASDSNLVVK DGYQWRKYGQ KVTRDNPCPR  180
AYFKCSFAPT CPVKKKVQRS VEDQSILVAT YEGEHNHPQS SLMEATSGTA AARCVGLTPA  240
APTTPLDSRK PKSPSEAKTT SSPRFQSPEM QQFLVEQMAS SLTKDPNFTA ALAAAISGKI  300
FPH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1100133KKRKSESSNNNNMVGINGNSESSSTDEESYKKPK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G80840.18e-87WRKY family protein