PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_023523748.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita; Cucurbita pepo
Family WRKY
Protein Properties Length: 332aa    MW: 36783.4 Da    PI: 8.5499
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_023523748.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY94.48.2e-30188247159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-ST.T---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsa.gCpvkkkversaedpkvveitYegeHnhe 59 
                     ++Dgy+WrKYGqK+ +++++pr+Y++C++a +Cpvkkkv+rs ed+++++ tYegeHnh+
  XP_023523748.1 188 VKDGYQWRKYGQKVTRDNPCPRAYFKCSFApTCPVKKKVQRSVEDQSILVATYEGEHNHP 247
                     58***************************99****************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    
MASSYSSWLD SVDTSLDLNL HPLRFTGEAP VTVSETASSS VLVYTQMGFL FSELGFFLFL  60
QKERNYLDHE KVSVKEETGA LMEELKRVSA ENKKLTEMLT VVCENYNTLR GHLVDQMNKN  120
GEKEVFCSKK RKSESSNNNN MVGINGNSES SSTDEESYKK PKQETINKSS KTTRVQVKIG  180
ASDSNLVVKD GYQWRKYGQK VTRDNPCPRA YFKCSFAPTC PVKKKVQRSV EDQSILVATY  240
EGEHNHPQSS LMEATSGTAA ARCVGLTPAA PTTPLDSRKP KSPSEAKTTS SPRFQSPEMQ  300
QFLVEQMASS LTKDPNFTAA LAAAISGKIF PH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1129162KKRKSESSNNNNMVGINGNSESSSTDEESYKKPK
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G80840.11e-84WRKY family protein