PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_023523407.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Cucurbiteae; Cucurbita; Cucurbita pepo
Family WRKY
Protein Properties Length: 549aa    MW: 59864.6 Da    PI: 7.4522
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_023523407.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY106.71.2e-33204261260
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                     dDgynWrKYGqK+vkgse+prsYY+Ct+++Cp+kkkvers  d++++ei+Y+g+Hnh+k
  XP_023523407.1 204 DDGYNWRKYGQKQVKGSENPRSYYKCTFPNCPTKKKVERSL-DGQITEIVYKGSHNHPK 261
                     8****************************************.***************85 PP

2WRKY1061.9e-33372430159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+vkg+++prsYY+Ct +gCpv+k+ver+++d ++v++tYeg+Hnhe
  XP_023523407.1 372 LDDGYRWRKYGQKVVKGNPNPRSYYKCTNPGCPVRKHVERASHDLRAVITTYEGKHNHE 430
                     59********************************************************8 PP

Sequence ? help Back to Top
Protein Sequence    Length: 549 aa     Download sequence    
MASSSGSLDT SANSHPSFTF STHPFMTTSY SDLLAAGSND LPSSAAAHGA HRGSGTGVPK  60
FKSLPPPSLP LLPPTLIPSS LFSIPPGLSP TELLDSPVLL SASYVLPSPT TGSFPSQSLN  120
WKNNSGYNQQ SIKEENKFLS EFSFLTQSSQ PPTSFQPAPT TEGKKQDGSM QSFSPEYGIV  180
QNQSQNNAGR DYPQQSQTVN RRSDDGYNWR KYGQKQVKGS ENPRSYYKCT FPNCPTKKKV  240
ERSLDGQITE IVYKGSHNHP KPQSTRKSSL SSAVSASNPA ANDMAEQSFT TQGSGQFDGV  300
ATPENSLISV GDDDFDRSSQ RSKSAGDDND DDEPEAKRRR DGDNNEGISA AGNRTVREPR  360
VVVQTTSDID ILDDGYRWRK YGQKVVKGNP NPRSYYKCTN PGCPVRKHVE RASHDLRAVI  420
TTYEGKHNHE VPPARGSGSH SLSRPFPSND LSATAIHPLA VTHRANNDAG GSNNKDNLLH  480
GLRLQQSSDN QTPFTLEMVQ NPNGFSFPEF GNSMGMGSYM NPTQSNDSLF VRAKEEPRDH  540
DMFIQSLLC
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.11e-109WRKY family protein